PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn109951
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ARR-B
Protein Properties Length: 635aa    MW: 69901.7 Da    PI: 7.2523
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn109951genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.76.2e-29187240155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 kpr++W+ eLH++Fv av+qL G+ekA+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  Achn109951 187 KPRVVWSIELHRKFVAAVNQL-GIEKAVPKRILDLMNVEGLTRENVASHLQKYRL 240
                 79*******************.********************************8 PP

2Response_reg839.3e-2831111109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+p+ ++ll ++l+k +y +v++++ ++ al++l+e++  +Dl++ D+ mp+mdG++ll++   e  +lp+i+++a+++++++ + +  Ga 
    Achn109951   3 VLAVDDDPTCLKLLDVLLRKCQY-QVTTTSRAKTALRMLRENQnrFDLVISDVHMPDMDGFKLLEHVGLEM-DLPVIMLSANSDPKLVMKGITHGAC 97 
                   799********************.***************888888**********************6644.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l+Kp+ +eel++
    Achn109951  98 DYLVKPVRIEELRN 111
                   ************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004481.4E-331113IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF521725.41E-361124IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.0E-421141No hitNo description
PIRSFPIRSF0363926.1E-1591633IPR017053Response regulator B-type, plant
PROSITE profilePS5011043.2582117IPR001789Signal transduction response regulator, receiver domain
PfamPF000729.5E-253112IPR001789Signal transduction response regulator, receiver domain
CDDcd001564.45E-294117No hitNo description
Gene3DG3DSA:1.10.10.604.0E-30184245IPR009057Homeodomain-like
SuperFamilySSF466891.51E-19184244IPR009057Homeodomain-like
PROSITE profilePS5129412.018184243IPR017930Myb domain
TIGRFAMsTIGR015571.3E-24187240IPR006447Myb domain, plants
PfamPF002494.5E-6189239IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 635 aa     Download sequence    Send to blast
MRVLAVDDDP TCLKLLDVLL RKCQYQVTTT SRAKTALRML RENQNRFDLV ISDVHMPDMD  60
GFKLLEHVGL EMDLPVIMLS ANSDPKLVMK GITHGACDYL VKPVRIEELR NIWQHVIRRK  120
KCEAKYENKS TPKDKTHQGN GEGGQGPSPT DNPDQNGRIN RKRKDEEEEE EGEENGSENE  180
DPGTQKKPRV VWSIELHRKF VAAVNQLGIE KAVPKRILDL MNVEGLTREN VASHLQKYRL  240
YLKRISSVAT QQANMVAALG GTDSSYMRSL SSLDAFGDFR TMAGQGRYPN PALSSYQTGG  300
IFDRLNCPTG VSLSSLSSAA LIQPSHAQNL SNSVNTLGKF QSVVLPKNQN TSSFQRIPTS  360
LEFDSPGDPT IFTSVGNASL FADNRAPLGI SSSSLPSASS NPLILQGNPQ QMQSGAVFGN  420
QSSLKVGSLN SEPFNTGLAV QISRFCTNSL LLTEPFNRDL LPPKSMRNIN SLSGPHIQNN  480
PDDFSSMSTI SSHMEDSRGE IQCQAGLIGD VRNMNQDMDK RWGEHNQAYV QHPHMVFSTV  540
NSMAPTKGVV GPLSQSVDQH NGVFRRETDT SLVSQSNSSA STLLQHSGVE KSAIYSKMRS  600
GEDYILEQTK SQGGFVHNGY DSLDELMISM IKRV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-25185246364ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010656582.10.0PREDICTED: two-component response regulator ARR12
RefseqXP_010656581.10.0PREDICTED: two-component response regulator ARR12
RefseqXP_002270833.20.0PREDICTED: two-component response regulator ARR12
SwissprotQ6H8051e-135ORR24_ORYSJ; Two-component response regulator ORR24
TrEMBLF6GZ310.0F6GZ31_VITVI; Putative uncharacterized protein
STRINGVIT_11s0206g00060.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22582458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-117response regulator 12